Recombinant Aspergillus kawachii Probable endo-beta-1,4-glucanase D (eglD)

Specification
Organism Aspergillus kawachii (strain NBRC 4308) (White koji mold) (Aspergillus awamori var. kawachi)
Expression Host E.coli
Tag Info N-terminal 10xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q96WQ9
Gene Names eglD
Alternative Names Carboxymethylcellulase D Cellulase 61A Cellulase D cel61A
Expression Region Full Length of Mature Protein(21-408aa )
Molecular Weight 45.2 kDa
Protein Sequence HTTVQAVWINGEDQGLGNTDDGYIRSPPSNSPVTDVTSTDMTCNVNGDQAASKTLSVKAGDVVTFEWHHSDRSDSDDIIASSHKGPVQVYMAPTAKGSNGNNWVKIAEDGYHKSSDEWATDILIANKGKHNITVPDVPAGNYLFRPEIIALHEGNREGGAQFYMECVQFKVTSDGSNELPSGVSIPGVYTATDPGILFDIYNSFDSYPIPGPDVWDGSSSGSSSSGSSSAAVSSAAAAATTSAVAATTPATQAAVEVSSSAAAATTEAAAPVVSSAAPVQQATSAVTSQAQAAPTTFATSSKKSSKTACKNKTKSNSQVAAATSSVVAPAATSSVVPVVSASASASAGGVAKQYERCGGINHTGPTTCESGSVCKKWNPYYYQCVASQ
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Has endoglucanase activity on substrates containing beta-1,4 glycosidic bonds, like in carboxymethylcellulose (CMC), hydroxyethylcellulose (HEC) and beta-glucan. Involved in the degradation of complex natural cellulosic substrates
Involvement in Disease
Subcellular Location Secreted
Protein Families Glycosyl hydrolase 61 family
Tissue Specificity eglD
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PEAPO836443

Recombinant Aspergillus kawachii Probable endo-beta-1,4-glucanase D (eglD)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Aspergillus kawachii Probable endo-beta-1,4-glucanase D (eglD)
Copyright © 2021-present Echo Biosystems. All rights reserved.