Recombinant Arachis hypogaea Arachin Ahy-3,partial

Specification
Organism Arachis hypogaea (Peanut)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q647H2
Gene Names N/A
Alternative Names Arachin Ahy-3 [Cleaved into: Arachin Ahy-3 chain alpha; Arachin Ahy-3 chain beta]
Expression Region Partial(299-478aa )
Molecular Weight 21.9 kDa
Protein Sequence GIEETICTATVKMNIGKSTSADIYNPQAGSVRTVNELDLPILNRLGLSAEYGSIHRDAMFVPHYNMNANSMIYALHGGAHVQVVDCNGNRVFDEELQEGQSLVVPQNFAVAAKSQSEHFLYVAFKTNSRASISNLAGKNSYMWNLPEDVVANSYGLQYEQARQLKNNNPFTFLVPPQDSQ
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance
Involvement in Disease
Subcellular Location
Protein Families 11S seed storage protein (globulins) family
Tissue Specificity N/A
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$392.00
In stock
SKU
EB-PYANE737516

Recombinant Arachis hypogaea Arachin Ahy-3,partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Arachis hypogaea Arachin Ahy-3,partial
Copyright © 2021-present Echo Biosystems. All rights reserved.