Specification
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Expression Host | Yeast |
| Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P39207 |
| Gene Names | NDK1 |
| Alternative Names | Nucleoside diphosphate kinase I Short name:NDK I Short name:NDP kinase I Short name:NDPK I |
| Expression Region | Full Length(1-149aa ) |
| Molecular Weight | 20.5 kDa |
| Protein Sequence | MEQTFIMIKPDGVQRGLIGEVICRFEKKGFTLKGLKLISVERSFAEKHYEDLSSKSFFSGLVDYIVSGPVVAMIWEGKNVVLTGRKIIGATNPAASEPGTIRGDFAIDIGRNVIHGSDSVESARKEIALWFPDGPVNWQSSVHPWVYET |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Plays a role in response to reactive oxygen species (ROS) stress. |
| Involvement in Disease | |
| Subcellular Location | Peroxisome, Nucleus, Cytoplasm |
| Protein Families | NDK family |
| Tissue Specificity | NDK1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |