Recombinant Arabidopsis thaliana Nuclear transcription factor Y subunit A-3(NFYA3)

Specification
Organism Arabidopsis thaliana (Mouse-ear cress)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q93ZH2
Gene Names NFYA3
Alternative Names Transcriptional activator HAP2;C
Expression Region Full Length(1-340aa )
Molecular Weight 41.6 kDa
Protein Sequence MMHQMLNKKDSATHSTLPYLNTSISWGVVPTDSVANRRGSAESLSLKVDSRPGHIQTTKQISFQDQDSSSTQSTGQSYTEVASSGDDNPSRQISFSAKSGSEITQRKGFASNPKQGSMTGFPNIHFAPAQANFSFHYADPHYGGLLAATYLPQAPTCNPQMVSMIPGRVPLPAELTETDPVFVNAKQYHAIMRRRQQRAKLEAQNKLIRARKPYLHESRHVHALKRPRGSGGRFLNTKKLLQESEQAAAREQEQDKLGQQVNRKTNMSRFEAHMLQNNKDRSSTTSGSDITSVSDGADIFGHTEFQFSGFPTPINRAMLVHGQSNDMHGGGDMHHFSVHI
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Involvement in Disease
Subcellular Location Nucleus
Protein Families NFYA/HAP2 subunit family
Tissue Specificity NFYA3
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEDOA856808

Recombinant Arabidopsis thaliana Nuclear transcription factor Y subunit A-3(NFYA3)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Arabidopsis thaliana Nuclear transcription factor Y subunit A-3(NFYA3)
Copyright © 2021-present Echo Biosystems. All rights reserved.