Recombinant Arabidopsis thaliana Lycopene beta cyclase, chloroplastic(LCY1)

Specification
Organism Arabidopsis thaliana (Mouse-ear cress)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q38933
Gene Names LCY1
Alternative Names LCY1; LCYB; LYC; SZL1; At3g10230; F14P13.17Lycopene beta cyclase; chloroplastic; EC 5.5.1.19; AtLCY; Protein SUPPRESSOR OF ZEAXANTHIN-LESS 1
Expression Region Full Length of Mature Protein(81-501aa )
Molecular Weight 63.1 kDa
Protein Sequence QVVDLAIVGGGPAGLAVAQQVSEAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDEGVKKDLSRPYGRVNRKQLKSKMLQKCITNGVKFHQSKVTNVVHEEANSTVVCSDGVKIQASVVLDATGFSRCLVQYDKPYNPGYQVAYGIVAEVDGHPFDVDKMVFMDWRDKHLDSYPELKERNSKIPTFLYAMPFSSNRIFLEETSLVARPGLRMEDIQERMAARLKHLGINVKRIEEDERCVIPMGGPLPVLPQRVVGIGGTAGMVHPSTGYMVARTLAAAPIVANAIVRYLGSPSSNSLRGDQLSAEVWRDLWPIERRRQREFFCFGMDILLKLDLDATRRFFDAFFDLQPHYWHGFLSSRLFLPELLVFGLSLFSHASNTSRLEIMTKGTVPLAKMINNLVQDRD
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Catalyzes the double cyclization reaction which converts lycopene to beta-carotene and neurosporene to beta-zeacarotene.
Involvement in Disease
Subcellular Location Plastid, chloroplast
Protein Families Lycopene cyclase family
Tissue Specificity LCY1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEDOA657254

Recombinant Arabidopsis thaliana Lycopene beta cyclase, chloroplastic(LCY1)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Arabidopsis thaliana Lycopene beta cyclase, chloroplastic(LCY1)
Copyright © 2026-present Echo Bio. All rights reserved.