Specification
Organism | Arabidopsis thaliana (Mouse-ear cress) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q1PER6 |
Gene Names | APX2 |
Alternative Names | L-ascorbate peroxidase 1b ;APX1b ;AtAPx02 |
Expression Region | Partial(4-250aa ) |
Molecular Weight | 31.5 kDa |
Protein Sequence | KSYPEVKEEYKKAVQRCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDVKTKTGGPFGTIRHPQELAHDANNGLDIAVRLLDPIKELFPILSYADFYQLAGVVAVEITGGPEIPFHPGRLDKVEPPPEGRLPQATKGVDHLRDVFGRMGLNDKDIVALSGGHTLGRCHKERSGFEGAWTPNPLIFDNSYFKEILSGEKEGLLQLPTDKALLDDPLFLPFVEKYAADEDAFFEDYTEAHLKLSELGFADK |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Plays a key role in hydrogen peroxide roval. |
Involvement in Disease | |
Subcellular Location | Cytoplasm |
Protein Families | Peroxidase family, Ascorbate peroxidase subfamily |
Tissue Specificity | APX2 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |