Specification
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Expression Host | Baculovirus |
| Protein Tag | N-terminal 6xHis-EGFP-tagged |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | Q9FHX5 |
| Gene Names | At5g42100 |
| Alternative Names | ((1->3)-beta-glucan endohydrolase 10)((1->3)-beta-glucanase 10)(Beta-1,3-endoglucanase 10)(Beta-1,3-glucanase 10)(Putative plasmodesmal associated protein)(AtBG_ppap) |
| Expression Region | 27-425aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.1231 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-1350℃. |
| Protein Length | Full Length of Mature Protein |
| Molecular Weight | 71.5 kDa |
| Protein Sequence | IGINYGQVANNLPPPKNVIPLLKSVGATKVKLYDADPQALRAFAGSGFELTVALGNEYLAQMSDPIKAQGWVKENVQAYLPNTKIVAIVVGNEVLTSNQSALTAALFPAMQSIHGALVDCGLNKQIFVTTAHSLAILDVSYPPSATSFRRDLLGSLTPILDFHVKTGSPILINAYPFFAYEENPKHVSLDFVLFQPNQGFTDPGSNFHYDNMLFAQVDAVYHALDAVGISYKKVPIVVSETGWPSNGDPQEVGATCDNARKYNGNLIKMMMSKKMRTPIRPECDLTIFVFALFNENMKPGPTSERNYGLFNPDGTPVYSLGIKTSSTHSSGSGSSNSTGGSSSGGGGNTGGSSSGGGIYQPVTGNPSPDYMSISSAGGKGRFVECVLFFFLLCIIKLRLKLLQPGR |
Background
| Research Areas | Others |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |