Specification
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Expression Host | E.coli |
| Protein Tag | N-terminal 6xHis-tagged |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | Q9SKU2 |
| Gene Names | EXPB1 |
| Alternative Names | (At-EXPB1)(AtEXPB1)(Ath-ExpBeta-1.5)(Beta-expansin-1) |
| Expression Region | 25-271aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.80 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-172℃. |
| Protein Length | Full Length of Mature Protein |
| Molecular Weight | 32.5 kDa |
| Protein Sequence | TPPLTHSNQQVAATRWLPATATWYGSAEGDGSSGGACGYGSLVDVKPFKARVGAVSPILFKGGEGCGACYKVRCLDKTICSKRAVTIIATDQSPSGPSAKAKHTHFDLSGAAFGHMAIPGHNGVIRNRGLLNILYRRTACKYRGKNIAFHVNAGSTDYWLSLLIEYEDGEGDIGSMHIRQAGSKEWISMKHIWGANWCIVEGPLKGPFSVKLTTLSNNKTLSATDVIPSNWVPKATYTSRLNFSPVL |
Background
| Research Areas | Others |
| Relevance | May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found. |
| Function | |
| Reference | "Analysis and expression of the alpha-expansin and beta-expansin gene families in maize." Wu Y., Meeley R.B., Cosgrove D.J. Plant Physiol. 126:222-232(2001) |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |