Specification
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9SV72 |
| Gene Names | EPFL9 |
| Alternative Names | EPF-like protein 9 |
| Expression Region | Full Length of Mature Protein(32-102aa ) |
| Molecular Weight | 10.2 |
| Protein Sequence | SRPRSIENTVSLLPQVHLLNSRRRHMIGSTAPTCTYNECRGCRYKCRAEQVPVEGNDPINSAYHYRCVCHR |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Stomagen: Positively regulates stomatal density and patterning. Acts by competing with EPF2 for the same receptors, ERECTA and TMM . Not cleaved by the protease CRSP . |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | EPFL9 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |