Specification
Organism | Arabidopsis thaliana (Mouse-ear cress) |
Expression Host | E.coli |
Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q9LIR6 |
Gene Names | BAM1 |
Alternative Names | 1,4-alpha-D-glucan maltohydrolase (Beta-amylase 7) (Thioredoxin-regulated beta-amylase) (TR-BAMY) (BMY7) (TRBAMY) |
Expression Region | Partial(42-354aa ) |
Molecular Weight | 41.7 kDa |
Protein Sequence | AMNRNYKAHGTDPSPPMSPILGATRADLSVACKAFAVENGIGTIEEQRTYREGGIGGKKEGGGGVPVFVMMPLDSVTMGNTVNRRKAMKASLQALKSAGVEGIMIDVWWGLVEKESPGTYNWGGYNELLELAKKLGLKVQAVMSFHQCGGNVGDSVTIPLPQWVVEEVDKDPDLAYTDQWGRRNHEYISLGADTLPVLKGRTPVQCYADFMRAFRDNFKHLLGETIVEIQVGMGPAGELRYPSYPEQEGTWKFPGIGAFQCYDKYSLSSLKAAAETYGKPEWGSTGPTDAGHYNNWPEDTQFFKKEGGGWNSE |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Beta-amylase activity. Can use p-nitrophenyl maltopentaoside as substrate only in reduced form. Can play a minor role in the starch degradation and maltose metabolism in chloroplasts during the night. More active on phosphorylated glucan. Interacts directly with starch or other alpha-1,4-glucan. |
Involvement in Disease | |
Subcellular Location | |
Protein Families | |
Tissue Specificity | BAM1 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |