Specification
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q96291 |
| Gene Names | BAS1 |
| Alternative Names | Thiol-specific antioxidant protein A |
| Expression Region | Full Length of Mature Protein(66-266aa ) |
| Molecular Weight | 24.4 kDa |
| Protein Sequence | KAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | May be an antioxidant enzyme particularly in the developing shoot and photosynthesizing leaf. Involved in the detoxification of alkyl hydroperoxides with reducing equivalents provided through the thioredoxin system. |
| Involvement in Disease | |
| Subcellular Location | Plastid, chloroplast |
| Protein Families | Peroxiredoxin family, AhpC/Prx1 subfamily |
| Tissue Specificity | BAS1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |