Recombinant Apomastus schlingeri U1-cyrtautoxin-As1c

Specification
Organism Apomastus schlingeri
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P49270
Gene Names N/A
Alternative Names Aptotoxin VI Aptotoxin-6 Paralytic peptide VI Short name:PP VI
Expression Region Full Length(1-76aa )
Molecular Weight 12.3 kDa
Protein Sequence EIPQNLGSGIPHDKIKLPNGQWCKTPGDLCSSSSECCKAKHSNSVTYASFCSRQWSGQQALFINQCRTCNVESSMC
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Is both paralytic and lethal, when injected into lepidopteran larvae.
Involvement in Disease
Subcellular Location Secreted
Protein Families Aptotoxin family
Tissue Specificity N/A
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEAMR344704

Recombinant Apomastus schlingeri U1-cyrtautoxin-As1c

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Apomastus schlingeri U1-cyrtautoxin-As1c
Copyright © 2021-present Echo Biosystems. All rights reserved.