Specification
| Organism | Apis mellifera (Honeybee) |
| Expression Host | E.coli |
| Protein Tag | N-terminal 6xHis-tagged |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | Q868N5 |
| Gene Names | Vg |
| Alternative Names | |
| Expression Region | 1439-1672aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.82 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-174℃. |
| Protein Length | Partial |
| Molecular Weight | 32.5 kDa |
| Protein Sequence | EDETSCMLDKTRAQTFDGKDYPLRLGPCWHAVMTTYPRINPDNHNEKLHIPKDKSVSVLSRENEAGQKEVKVLLGSDKIKFVPGTTSQPEVFVNGEKIVVSRNKAYQKVEENEIIFEIYKMGDRFIGLTSDKFDVSLALDGERVMLKASEDYRYSVRGLCGNFDHDSTNDFVGPKNCLFRKPEHFVASYALISNQCEGDSLNVAKSLQDHDCIRQERTQQRNVISDSESGRLDT |
Background
| Research Areas | Others |
| Relevance | Precursor of the egg-yolk proteins that are sources of nutrients during embryonic development. Involved in the differentiation of honeybee larvae into queens. |
| Function | |
| Reference | "The vitellogenin of the honey bee, Apis mellifera: structural analysis of the cDNA and expression studies." Piulachs M.D., Guidugli K.R., Barchuk A.R., Cruz J., Simoes Z.L.P., Belles X. Insect Biochem. Mol. Biol. 33:459-465(2003) |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |