Specification
| Organism | Apis mellifera (Honeybee) |
| Expression Host | E.coli |
| Protein Tag | N-terminal 10xHis-tagged |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | P17722 |
| Gene Names | N/A |
| Alternative Names | (Royalisin) |
| Expression Region | 44-94aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.79 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-171℃. |
| Protein Length | Full Length of Mature Protein |
| Molecular Weight | 11.6 kDa |
| Protein Sequence | VTCDLLSFKGQVNDSACAANCLSLGKAGGHCEKGVCICRKTSFKDLWDKRF |
Background
| Research Areas | Others |
| Relevance | Found in royal jelly and in hemolymph, potent antibacterial protein against Gram-positive bacteria at low concentration. |
| Function | |
| Reference | "Two structurally different defensin genes, one of them encoding a novel defensin isoform, are expressed in honeybee Apis mellifera." Klaudiny J., Albert S., Bachanova K., Kopernicky J., Simuth J. Insect Biochem. Mol. Biol. 35:11-22(2005) |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |