Recombinant Anemonia sulcata GFP-like non-fluorescent chromoprotein FP595

Specification
Organism Anemonia sulcata (Mediterranean snakelocks sea anemone)
Expression Host Mammalian cell
Tag Info C-terminal hFc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q9GZ28
Gene Names N/A
Alternative Names asFP595
Expression Region Full Length of Mature Protein(1-62aa )
Molecular Weight 35.7
Protein Sequence MASFLKKTMPFKTTIEGTVNGHYFKCTGKGEGNPFEGTQEMKIEVIEGGPLPFAFHILSTSC
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Pigment protein that is intensely purple in color.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity N/A
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$594.00
In stock
SKU
EB-PMAKE888057

Recombinant Anemonia sulcata GFP-like non-fluorescent chromoprotein FP595

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Anemonia sulcata GFP-like non-fluorescent chromoprotein FP595
Copyright © 2021-present Echo Biosystems. All rights reserved.