Specification
| Organism | Anaplasma phagocytophilum (strain HZ) |
| Expression Host | E.coli |
| Tag Info | N-terminal 10xHis-tagged and C-terminal MYC-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q2GL54 |
| Gene Names | rplV |
| Alternative Names | rplV; APH_0285; 50S ribosomal protein L22 |
| Expression Region | Full Length(1-112aa ) |
| Molecular Weight | 17.2 kDa |
| Protein Sequence | MSIVIAAKGLGLRSTPAKLNLVADLIRGKDVAVAAMYLKFCKKKAALLIDKVLKSAIANARANYGVDADNLYVKEVLVGKAFTLRRVQPRARGRACRISKRYGSVVVKLLER |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | This protein binds specifically to 23S rRNA; its binding is stimulated by other ribosomal proteins, e.g. L4, L17, and L20. It is important during the early stages of 50S assembly. It makes multiple contacts with different domains of the 23S rRNA in the assembled 50S subunit and ribosome.UniRule annotation The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wall of the exit tunnel in the center of the 70S ribosome. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | Universal ribosomal protein uL22 family |
| Tissue Specificity | rplV |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
