Recombinant Anaplasma phagocytophilum 50S ribosomal protein L22(rplV)

Specification
Organism Anaplasma phagocytophilum (strain HZ)
Expression Host in vitro E.coli expression system
Tag Info N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q2GL54
Gene Names rplV
Alternative Names rplV; APH_0285; 50S ribosomal protein L22
Expression Region Full Length(1-112aa )
Molecular Weight 32.2 kDa
Protein Sequence MSIVIAAKGLGLRSTPAKLNLVADLIRGKDVAVAAMYLKFCKKKAALLIDKVLKSAIANARANYGVDADNLYVKEVLVGKAFTLRRVQPRARGRACRISKRYGSVVVKLLER
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance This protein binds specifically to 23S rRNA; its binding is stimulated by other ribosomal proteins, e.g. L4, L17, and L20. It is important during the early stages of 50S assembly. It makes multiple contacts with different domains of the 23S rRNA in the assembled 50S subunit and ribosome The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wall of the exit tunnel in the center of the 70S ribosome.
Involvement in Disease
Subcellular Location
Protein Families Universal ribosomal protein uL22 family
Tissue Specificity rplV
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$754.00
In stock
SKU
EB-PCAAQ641406

Recombinant Anaplasma phagocytophilum 50S ribosomal protein L22(rplV)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Anaplasma phagocytophilum 50S ribosomal protein L22(rplV)
Copyright © 2021-present Echo Biosystems. All rights reserved.