Recombinant Amylomyces rouxii Chitin deacetylase

Specification
Organism Amylomyces rouxii(Filamentous fungus)(Mucor rouxii)
Expression Host E.coli
Tag Info N-terminal 10xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P50325
Gene Names N/A
Alternative Names Chitin deacetylase; EC 3.5.1.41
Expression Region Full Length of Mature Protein(22-421aa )
Molecular Weight 49.9 kDa
Protein Sequence DTSANYWQSFTSQINPKNISIPSIEQTSSIDPTQECAYYTPDASLFTFNASEWPSIWEVATTNGMNESAEFLSVYNSIDWTKAPNISVRTLDANGNLDTTGYNTATDPDCWWTATTCTSPKISDINDDISKCPEPETWGLTYDDGPNCSHNAFYDYLQEQKLKASMFYIGSNVVDWPYGAMRGVVDGHHIASHTWSHPQMTTKTNQEVLAEFYYTQKAIKLATGLTPRYWRPPYGDIDDRVRWIASQLGLTAVIWNLDTDDWSAGVTTTVEAVEQSYSDYIAMGTNGTFANSGNIVLTHEINTTMSLAVENLPKIISAYKQVIDVATCYNISHPYFEDYEWTNVLNGTKSSATASGSATSASASGGATTAAAHIQASTSGAMSVLPNLALISAFIATLLF
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Hydrolyzes the N-acetamido groups of N-acetyl-D-glucosamine residues in chitin. This enzyme specifically acts on beta-1-4-linked N-acetylglucosamine homopolymers and requires at least 4 residues for catalysis.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity N/A
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEAJI344766

Recombinant Amylomyces rouxii Chitin deacetylase

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Amylomyces rouxii Chitin deacetylase
Copyright © 2021-present Echo Biosystems. All rights reserved.