Recombinant Akkermansia muciniphila Crossover junction endodeoxyribonuclease RuvC(ruvC)

Specification
Organism Akkermansia muciniphila (strain ATCC BAA-835 / Muc)
Expression Host E.coli
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID B2UP63
Gene Names ruvC
Alternative Names Holliday junction nuclease RuvC Holliday junction resolvase RuvC
Expression Region Full Length(1-167aa )
Molecular Weight 23.2 kDa
Protein Sequence MRILAIDPAIRNTGYAVVEGDYRRARALDYGTLSIPRSVSQSGCLLAIKQHLGNLIDKWNPDEMAVERIIYVQSHQTAITMGAAKAAVVIAAAEAGLRIMEYSPKSVKLSVVGRGAAQKTQVAFMVRALLELRETPESDAADALAIGLTHLFSADPLKAHMMERKYI
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Nuclease that resolves Holliday junction intermediates in genetic recombination. Cleaves the cruciform structure in supercoiled DNA by nicking to strands with the same polarity at sites symmetrically opposed at the junction in the homologous arms and leaves a 5'-terminal phosphate and a 3'-terminal hydroxyl group.
Involvement in Disease
Subcellular Location
Protein Families RuvC family
Tissue Specificity ruvC
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEAZF453127

Recombinant Akkermansia muciniphila Crossover junction endodeoxyribonuclease RuvC(ruvC)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Akkermansia muciniphila Crossover junction endodeoxyribonuclease RuvC(ruvC)
Copyright © 2021-present Echo Biosystems. All rights reserved.