Recombinant African swine fever virus Virus attachment protein p12(Pret-110)

Specification
Organism African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) (ASFV)
Expression Host in vitro E.coli expression system
Tag Info N-terminal 10xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P0C9Y3
Gene Names Pret-110
Alternative Names Protein p12
Expression Region Full Length(1-61aa )
Molecular Weight 12.7 kDa
Protein Sequence MALDGSSGGGSNVETLLIVAIIVVIMAIMLYYFWWMPRQQKKCSKAEECTCNNGSCSLKTS
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity Pret-110
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$1,498.00
In stock
SKU
EB-PCAYG315599

Recombinant African swine fever virus Virus attachment protein p12(Pret-110)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant African swine fever virus Virus attachment protein p12(Pret-110)
Copyright © 2026-present Echo Bio. All rights reserved.