Recombinant African swine fever virus Uncharacterized protein K145R (Mal-059)

Specification
Organism African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)
Expression Host Yeast
Protein Tag N-terminal 6xHis-sumostar-tagged
Purity Greater than 90% as determined by SDS-PAGE.
Endotoxin Level
Biological Activity
Uniprot ID P0CA49
Gene Names Mal-059
Alternative Names (pK145R)
Expression Region 1-145aa
Product Form Liquid or Lyophilized powder
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.1699 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-1821℃.
Protein Length Full Length
Molecular Weight 30.3 kDa
Protein Sequence MDHYLKKLEDIYKKLEGHPFLFSPSKTNEKEFITLLNQALASTQLYRSIQQLFLTMYKLDPIGFINYIKTSKQEYLCLLINPKLVTKFLKITSFKIYINFRLKTFYISPNKYNNFYTAPSEEKANHLLKEEKTWAKIVEEGGEES
Background
Research Areas Signal Transduction
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$425.00
In stock
SKU
EB-N232742

Protein expressed from mulitple host is available with various size. Please inquiry us if you need any customized needs.

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant African swine fever virus Uncharacterized protein K145R (Mal-059)
Copyright © 2026-present Echo Bio. All rights reserved.