Recombinant African swine fever virus CD2 homolog, partial

Specification
Gene Names N/A
Alternative Names CD2H;5HL;CD2v;T-lymphocyte CD2 receptor-like protein;CD2-like protein;pEP402R
Organism African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV)
Expression Host Yeast
Molecular Weight 23.0 kDa
Expression Region Partial(17-204aa )
Expression Region C-terminal 6xHis-tagged(Partial )
Purity Greater than 90% as determined by SDS-PAGE.
Endotoxin Not test.
Form Liquid or Lyophilized powder
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Protein Sequence NIIIWSTLNQTVFLNNIFTINDTYGGLFWNTYYDNNRSNFTYCGIAGNYCSCCGHNISLYNTTNNCSLIIFPNNTEIFNRTYELVYLDKKINYTVKLLKSVDSPTITYNCTNSLITCKNNNGTNVNIYLIINNTIVNDTNGDILNYYWNGNNNFTATCMINNTISSLNETENINCTNPILKYQNYLST
Background
Research Areas Others
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$405.00
In stock
SKU
EB-YAEJ2410893

Recombinant African swine fever virus CD2 homolog, partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant African swine fever virus CD2 homolog, partial
Copyright © 2026-present Echo Bio. All rights reserved.