Specification
| Organism | Absidia glauca (Pin mould) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P10982 |
| Gene Names | ACT1 |
| Alternative Names | ACT1Actin-1; Fragment |
| Expression Region | Partial(1-140aa ) |
| Molecular Weight | 21.2 kDa |
| Protein Sequence | MSMEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKSNREKMTQIMFETFNAPAFYVSIQA |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. |
| Involvement in Disease | |
| Subcellular Location | Cytoplasm, cytoskeleton |
| Protein Families | Actin family |
| Tissue Specificity | ACT1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |