Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens DNA polymerase epsilon 3, accessory subunit (POLE3), transcript variant 1 (NM_017443). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9NRF9 |
| Entry Name | DPOE3_HUMAN |
| Gene Names | POLE3 CHRAC17 |
| Alternative Gene Names | CHRAC17 |
| Alternative Protein Names | DNA polymerase epsilon subunit 3 (Arsenic-transactivated protein) (AsTP) (Chromatin accessibility complex 17 kDa protein) (CHRAC-17) (HuCHRAC17) (DNA polymerase II subunit 3) (DNA polymerase epsilon subunit p17) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 147 |
| Molecular Weight(Da) | 16860 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQNEEEEVDN |
Background
| Function | FUNCTION: Accessory component of the DNA polymerase epsilon complex (PubMed:10801849). Participates in DNA repair and in chromosomal DNA replication (By similarity). Forms a complex with CHRAC1 and binds naked DNA, which is then incorporated into chromatin, aided by the nucleosome-remodeling activity of ISWI/SNF2H and ACF1 (PubMed:10801849). Does not enhance nucleosome sliding activity of the ACF-5 ISWI chromatin remodeling complex (PubMed:14759371). {ECO:0000250|UniProtKB:Q04603, ECO:0000269|PubMed:10801849, ECO:0000269|PubMed:14759371}. |
| Pathway | |
| Protein Families | |
| Tissue Specificity | Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. {ECO:0000269|PubMed:10880450}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |