Recombinant Human GCNT2 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens glucosaminyl (N-acetyl) transferase 2 (I blood group) (GCNT2), transcript variant 3 (NM_145655).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q8N0V5
Entry Name GNT2A_HUMAN
Gene Names GCNT2 GCNT5 II NACGT1
Alternative Gene Names GCNT5 II NACGT1
Alternative Protein Names N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase (N-acetylglucosaminyltransferase) (EC 2.4.1.150) (I-branching enzyme) (IGNT)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 402
Molecular Weight(Da) 45873
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MMGSWKHCLFSASLISALIFVFVYNTELWENKRFLRAALSNASLLAEACHQIFEGKVFYPTENALKTTLDEATCYEYMVRSHYVTETLSEEEAGFPLAYTVTIHKDFGTFERLFRAIYMPQNVYCVHLDQKATDAFKGAVKQLLSCFPNAFLASKKESVVYGGISRLQADLNCLEDLVASEVPWKYVINTCGQDFPLKTNREIVQYLKGFKGKNITPGVLPPDHAVGRTKYVHQELLNHKNSYVIKTTKLKTPPPHDMVIYFGTAYVALTRDFANFVLQDQLALDLLSWSKDTYSPDEHFWVTLNRIPGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSWYF
Background
Function FUNCTION: Branching enzyme that converts linear into branched poly-N-acetyllactosaminoglycans. Introduces the blood group I antigen during embryonic development. It is closely associated with the development and maturation of erythroid cells. {ECO:0000269|PubMed:7579796, ECO:0000269|PubMed:8449405}.; FUNCTION: [Isoform C]: Determines the expression of the blood group I antigen in erythrocytes. {ECO:0000269|PubMed:12468428}.
Pathway Protein modification; protein glycosylation.
Protein Families Glycosyltransferase 14 family
Tissue Specificity [Isoform B]: Expressed in lens epithelium cells. {ECO:0000269|PubMed:12424189}.; TISSUE SPECIFICITY: [Isoform C]: Expressed in reticulocytes. {ECO:0000269|PubMed:12468428}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8438296

Recombinant Human GCNT2 protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human GCNT2 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.