Recombinant Human FCGR3B protein

Specification
Description Recombinant protein from the full-length sequence of homo sapiens Fc fragment of IgG receptor IIIb (FCGR3B), transcript variant 2 (NM_000570).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID O75015
Entry Name FCG3B_HUMAN
Gene Names FCGR3B CD16B FCG3 FCGR3 IGFR3
Alternative Gene Names CD16B FCG3 FCGR3 IGFR3
Alternative Protein Names Low affinity immunoglobulin gamma Fc region receptor III-B (Fc-gamma RIII-beta) (Fc-gamma RIII) (Fc-gamma RIIIb) (FcRIII) (FcRIIIb) (FcR-10) (IgG Fc receptor III-1) (CD antigen CD16b)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 233
Molecular Weight(Da) 26216
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQVSFCLVMVLLFAVDTGLYFSVKTNI
Background
Function FUNCTION: Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
Pathway
Protein Families
Tissue Specificity Expressed specifically by polymorphonuclear leukocytes (neutrophils). Also expressed by stimulated eosinophils.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8457475

Recombinant Human FCGR3B protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human FCGR3B protein
Copyright © 2026-present Echo Bio. All rights reserved.