Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens CD52 molecule (CD52) (NM_001803). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P31358 |
| Entry Name | CD52_HUMAN |
| Gene Names | CD52 CDW52 HE5 |
| Alternative Gene Names | CDW52 HE5 |
| Alternative Protein Names | CAMPATH-1 antigen (CDw52) (Cambridge pathology 1 antigen) (Epididymal secretory protein E5) (Human epididymis-specific protein 5) (He5) (CD antigen CD52) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 61 |
| Molecular Weight(Da) | 6614 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS |
Background
| Function | FUNCTION: May play a role in carrying and orienting carbohydrate, as well as having a more specific role. |
| Pathway | |
| Protein Families | |
| Tissue Specificity |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |