Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens C-C motif chemokine ligand 26 (CCL26), transcript variant 3 (NM_006072). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9Y258 |
| Entry Name | CCL26_HUMAN |
| Gene Names | CCL26 SCYA26 UNQ216/PRO242 |
| Alternative Gene Names | SCYA26 |
| Alternative Protein Names | C-C motif chemokine 26 (CC chemokine IMAC) (Eotaxin-3) (Macrophage inflammatory protein 4-alpha) (MIP-4-alpha) (Small-inducible cytokine A26) (Thymic stroma chemokine-1) (TSC-1) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 94 |
| Molecular Weight(Da) | 10648 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MMGLSLASAVLLASLLSLHLGTATRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL |
Background
| Function | FUNCTION: Chemoattractant for eosinophils and basophils (PubMed:10415065, PubMed:10488147). Acts as a ligand for C-C chemokine receptor CCR3 which triggers Ca(2+) mobilization in eosinophils (PubMed:10415065, PubMed:10488147, PubMed:11425309). Also acts as a ligand for CX3C chemokine receptor CX3CR1, inducing cell chemotaxis (PubMed:20974991). {ECO:0000269|PubMed:10415065, ECO:0000269|PubMed:10488147, ECO:0000269|PubMed:11425309, ECO:0000269|PubMed:20974991}. |
| Pathway | |
| Protein Families | Intercrine beta (chemokine CC) family |
| Tissue Specificity | Ubiquitously expressed at low levels in various tissues including heart and ovary. {ECO:0000269|PubMed:10373330, ECO:0000269|PubMed:10488147}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |