Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens calcitonin related polypeptide beta (CALCB) (NM_000728). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P10092 |
| Entry Name | CALCB_HUMAN |
| Gene Names | CALCB CALC2 |
| Alternative Gene Names | CALC2 |
| Alternative Protein Names | Calcitonin gene-related peptide 2 (Beta-type CGRP) (Beta-CGRP) (Calcitonin gene-related peptide II) (CGRP-II) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 127 |
| Molecular Weight(Da) | 13706 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGRRRRDLQA |
Background
| Function | FUNCTION: CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role. |
| Pathway | |
| Protein Families | Calcitonin family |
| Tissue Specificity |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |