Specification
| Target Name | S |
| Uniprot ID | K0BRG7 |
| Organism | Human betacoronavirus 2c EMC/2012 |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Sequence Desciption | Partial |
| Sequence | EAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEY |
| Molecular Weight | 28.3 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin | Not test. |
| Biological Activity | Please contact us for the specific biological activity data. |
| Product Form | Liquid or Lyophilized powder |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Background
| N/A. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
