Rcombinant Human Basigin(BSG),partial

Specification
Target Name BSG/ CD147
Uniprot ID P35613
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Sequence Desciption Partial
Sequence EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSH
Molecular Weight 24.2 kDa
Purity Greater than 90% as determined by SDS-PAGE.
Endotoxin Not test.
Biological Activity Please contact us for the specific biological activity data.
Product Form Liquid or Lyophilized powder
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Background
N/A.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$201.00
In stock
SKU
EB-CRP12313474h

Rcombinant Human Basigin(BSG),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Rcombinant Human Basigin(BSG),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.