Specification
| Target Name | S |
| Uniprot ID | P59594 |
| Organism | SARS-CoV |
| Expression Host | Mammalian cell |
| Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Sequence Desciption | Partial |
| Sequence | RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF |
| Molecular Weight | 30 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Biological Activity | Please contact us for the specific biological activity data. |
| Product Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Background
| N/A. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |