Specification
Target Name | S |
Uniprot ID | P59594 |
Organism | SARS-CoV |
Expression Host | Mammalian cell |
Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Sequence Desciption | Partial |
Sequence | RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF |
Molecular Weight | 30 kDa |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Biological Activity | Please contact us for the specific biological activity data. |
Product Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Background
N/A. |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |