Recombinant Severe acute respiratory syndrome coronavirus Spike glycoprotein(S),partial

Specification
Target Name S
Uniprot ID P59594
Organism SARS-CoV
Expression Host Mammalian cell
Tag Info C-terminal 6xHis-tagged
Sequence Desciption Partial
Sequence RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF
Molecular Weight 27.2 kDa
Purity Greater than 90% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/ug as determined by LAL method.
Biological Activity Please contact us for the specific biological activity data.
Product Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm sterile fiiltered 20mM Tris-HCl,400mM NaCl,6% Trehalose,pH 7.0
Background
N/A.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$356.00
In stock
SKU
EB-CMP349219763HQEc7

Recombinant Severe acute respiratory syndrome coronavirus Spike glycoprotein(S),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Severe acute respiratory syndrome coronavirus Spike glycoprotein(S),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.