Recombinant Bovine coronavirus Nucleoprotein(N)

Specification
Target Name N
Uniprot ID P10527
Organism Bovine coronavirus(strain Mebus)(BCoV)(BCV)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Sequence Desciption Full Length
Sequence MSFTPGKQSSSRASFGNRSGNGILKWADQSDQSRNVQTRGRRAQPKQTATSQLPSGGNVVPYYSWFSGITQFQKGKEFEFAEGQGVPIAPGVPATEAKGYWYRHNRRSFKTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVFWVASNQADVNTPADILDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRSTSRASSRASSAGSRSRANSGNRTPTSGVTPDMADQIASLVLAKLGKDATKPQQVTKQTAKEIRQKILNKPRQKRSPNKQCTVQQCFGKRGPNQNFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLELAKVQNLSGNLDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAYQQQDGMMNMSPKPQRQRGQKNGQGENDNISVAAPKSRVQQNKSRELTAEDISLLKKMDEPYTEDTSEI
Molecular Weight 55.3 kDa
Purity Greater than 85% as determined by SDS-PAGE.
Endotoxin Not test.
Biological Activity Please contact us for the specific biological activity data.
Product Form Liquid or Lyophilized powder
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Background
N/A.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-CEP32632868BJK

Recombinant Bovine coronavirus Nucleoprotein(N)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Bovine coronavirus Nucleoprotein(N)
Copyright © 2021-present Echo Biosystems. All rights reserved.