Recombinant Portulaca grandiflora 4,5-DOPA dioxygenase extradiol(DODA)

Specification
Organism Portulaca grandiflora (Rose moss)
Expression Host E.coli
Tag Info N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q7XA48
Gene Names DODA
Alternative Names DODA4,5-DOPA dioxygenase extradiol; EC 1.13.11.29
Expression Region Full Length(1-271aa )
Molecular Weight 49.9 kDa
Protein Sequence MGVGKEVSFKESFFLSHGNPAMLADESFIARNFLLGWKKNVFPVKPKSILVVSAHWETDVPCVSAGQYPNVIYDFTEVPASMFQMKYPAPGCPKLAKRVQELLIAGGFKSAKLDEERGFDHSSWVPLSMMCPEADIPVCQLSVQPGLDATHHFNVGRALAPLKGEGVLFIGSGGAVHPSDDTPHWFDGVAPWAAEFDQWLEDALLEGRYEDVNNYQTKAPEGWKLAHPIPEHFLPLHVAMGAGGEKSKAELIYRTWDHGTLGYASYKFTSI
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Opens the cyclic ring of dihydroxy-phenylalanine (DOPA) between carbons 4 and 5, thus producing an unstable seco-DOPA that rearranges nonenzymatically to betalamic acid.
Involvement in Disease
Subcellular Location Cytoplasm
Protein Families DODA-type extradiol aromatic ring-opening dioxygenase family
Tissue Specificity DODA
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEIAD767230

Recombinant Portulaca grandiflora 4,5-DOPA dioxygenase extradiol(DODA)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Portulaca grandiflora 4,5-DOPA dioxygenase extradiol(DODA)
Copyright © 2021-present Echo Biosystems. All rights reserved.