Specification
| Organism | Sus scrofa (Pig) |
| Expression Host | Baculovirus |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O02705 |
| Gene Names | HSP90AA1 |
| Alternative Names | HSP90AA1; HSP90A; HSPCAHeat shock protein HSP 90-alpha |
| Expression Region | Partial(222-367aa ) |
| Molecular Weight | 19.7 kDa |
| Protein Sequence | VEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNNIKLYVR |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function (By similarity). Binds bacterial lipopolysaccharide (LPS) et mediates LPS-induced inflammatory response, including TNF secretion (By similarity). |
| Involvement in Disease | |
| Subcellular Location | Nucleus, Cytoplasm, Melanosome, Cell membrane |
| Protein Families | Heat shock protein 90 family |
| Tissue Specificity | HSP90AA1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |