Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | E.coli |
| Tag Info | Tag-Free |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Uniprot ID | P10749 |
| Uniprot Entry Name | |
| Gene Names | Il1b |
| Alternative Names | Interleukin-1 Beta; IL-1 Beta; Il1b |
| Expression Region | Full Length of Mature Protein (118-269aa) |
| Molecular Weight | 17.4 kDa |
| Endotoxin | Less than 1.0 EU/µg as determined by LAL method. |
| Sequence | VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS |
| Product Form | Lyophilized powder (Lyophilized from a 0.2 μm Filtered 50 mM Tris-HCl, 50 mM NaCl, pH 8.0) |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Background
| Relevance | Interleukin-1 (IL-1) designates two proteins, IL-1α and IL-1β, which are the products of distinct genes, but recognize the same cell surface receptors. IL-1α and IL-1β are structurally related polypeptides that show approximately 25% homology at the amino acid level. Both proteins are produced by a wide variety of cells in response to stimuli such as those produced by inflammatory agents, infections, or microbial endotoxins. The proteins are synthesized as 31 kDa precursors that are subsequently cleaved into proteins with molecular weights of approximately 17.5 kDa. The specific protease responsible for the processing of IL-1β, designated interleukin 1β-converting enzyme (ICE), has been described. Mature human and mouse IL-1β share approximately 75% amino acid sequence identity and human IL-1β has been found to be active on murine cell lines. |
| Function | Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. |
| Involvement in disease | |
| Subcellular Location | Cytoplasm, cytosol, Lysosome, Secreted, exosome, Cytoplasmic vesicle, autophagosome, Secreted |
| Protein Families | IL-1 family |
| Tissue Specificity | Expressed in activated macrophages (at protein level). |
| Pathway |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
