Recombinant Mouse Hepatitis A virus cellular receptor 2 homolog(Havcr2),partial (Active)

Specification
Organism Mus musculus (Mouse)
Expression Host Mammalian cell
Tag Info C-terminal Fc-tagged
Purity Greater than 90% as determined by SDS-PAGE.
Uniprot ID Q8VIM0
Uniprot Entry Name
Gene Names Havcr2
Alternative Names Hepatitis A virus cellular receptor 2 homolog; HAVcr-2; T-cell immunoglobulin and mucin domain-containing protein 3; T-cell immunoglobulin mucin receptor 3; T-cell membrane protein 3; Tim3; Timd3
Expression Region Extracellular Domain (20-191aa)
Molecular Weight 46.3 kDa
Endotoxin Less than 1.0 EU/µg as determined by LAL method.
Sequence RSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIR
Product Form Lyophilized powder (Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4)
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Background
Relevance T cell immunoglobulin and mucin domain-3 (TIM3), also called hepatitis A virus cellular receptor 2 (HAVCR2), is a transmembrane glycoprotein of the TIM family of immune regulating molecules and plays an important role in the Th1-mediated immune response. TIM3 is expressed on the Th1 cells, CD8 T-cells, monocytes, and dendritic cells, but not on Th2 cells. TIM3 expressed by monocytes and dendritic cells facilitates phagocytosis of apoptotic cells and up-regulates cross-presentation of apoptotic cell-associated antigens through interaction with phosphatidylserine. Engagement of TIM3 by its ligand galectin-9 induces a range of immunosuppressive functions which enhance immune tolerance and inhibit anti-tumor immunity. Stimulation of TIM3 with an agonistic antibody promotes inflammation through the activation of innate immune cells. TIM3 is also regarded as a potential target molecule for immunotherapy. TIM3 and programmed cell death 1 (PD-1) as two important coinhibitory regulators of T cell responses, have been implicated with the T-cell dysfunction or exhaustion associated with chronic HBV infection including HBV-related HCC.
Function Cell surface receptor implicated in modulating innate and adaptive immune responses. Generally accepted to have an inhibiting function. Reports on stimulating functions suggest that the activity may be influenced by the cellular context and/or the respective ligand
Involvement in disease
Subcellular Location Isoform 1: Membrane, Single-pass type I membrane protein, Cell junction
Protein Families Immunoglobulin superfamily, TIM family
Tissue Specificity Expressed in T-helper type 1 lymphocytes. Not expressed by naive T-cells but up-regulated as they differentiate into T-helper-1 cells. Also expressed by differentiated type 1 CD8+ cytotoxic T-cells. Expressed on peritoneal exudate macrophages, monocytes, and splenic dendritic cells (DCs). Expression on natural killer (NK) cells is inversely associated with IFN-gamma production during the initial 24 h of LPS-induced endotoxic shock. Expressed on mast cells.
Pathway
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$131.00
In stock
SKU
EB-CAPMO5466

Recombinant Mouse Hepatitis A virus cellular receptor 2 homolog(Havcr2),partial (Active)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Hepatitis A virus cellular receptor 2 homolog(Havcr2),partial (Active)
Copyright © 2021-present Echo Biosystems. All rights reserved.