Recombinant Human ZNHIT1 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens zinc finger HIT-type containing 1 (ZNHIT1) (NM_006349).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID O43257
Entry Name ZNHI1_HUMAN
Gene Names ZNHIT1 CGBP1 ZNFN4A1
Alternative Gene Names CGBP1 ZNFN4A1
Alternative Protein Names Zinc finger HIT domain-containing protein 1 (Cyclin-G1-binding protein 1) (Zinc finger protein subfamily 4A member 1) (p18 Hamlet)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 154
Molecular Weight(Da) 17536
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV
Background
Function FUNCTION: Seems to play a role in p53-mediated apoptosis induction (PubMed:17380123). Binds to NR1D2 and relieves it of its inhibitory effect on the transcription of APOC3 without affecting its DNA-binding activity (PubMed:17892483). {ECO:0000269|PubMed:17380123, ECO:0000269|PubMed:17892483}.
Pathway
Protein Families ZNHIT1 family
Tissue Specificity Expressed abundantly in liver, but weakly in skeletal muscle, ovary and small intestine. {ECO:0000269|PubMed:17892483}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8580775

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human ZNHIT1 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.