Recombinant Human ZMYND19 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens zinc finger MYND-type containing 19 (ZMYND19) (NM_138462).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q96E35
Entry Name ZMY19_HUMAN
Gene Names ZMYND19 MIZIP
Alternative Gene Names MIZIP
Alternative Protein Names Zinc finger MYND domain-containing protein 19 (Melanin-concentrating hormone receptor 1-interacting zinc finger protein) (MCH-R1-interacting zinc finger protein)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 227
Molecular Weight(Da) 26433
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MTDFKLGIVRLGRVAGKTKYTLIDEQDIPLVESYSFEARMEVDADGNGAKIFAYAFDKNRGRGSGRLLHELLWERHRGGVAPGFQVVHLNAVTVDNRLDNLQLVPWGWRPKAEETSSKQREQSLYWLAIQQLPTDPIEEQFPVLNVTRYYNANGDVVEEEENSCTYYECHYPPCTVIEKQLREFNICGRCQVARYCGSQCQQKDWPAHKKHCRERKRPFQHELEPER
Background
Function FUNCTION: May be involved as a regulatory molecule in GPR24/MCH-R1 signaling.
Pathway
Protein Families
Tissue Specificity Expressed in brain, testis, placenta, heart, liver, skeletal muscle, kidney and stomach. {ECO:0000269|PubMed:12208518}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8731425

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human ZMYND19 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.