Recombinant Human ZDHHC12 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens zinc finger DHHC-type palmitoyltransferase 12 (ZDHHC12), transcript variant 5 (NM_032799).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q96GR4
Entry Name ZDH12_HUMAN
Gene Names ZDHHC12 ZNF400 PSEC0008
Alternative Gene Names ZNF400
Alternative Protein Names Palmitoyltransferase ZDHHC12 (EC 2.3.1.225) (DHHC domain-containing cysteine-rich protein 12) (DHHC-12) (Zinc finger DHHC domain-containing protein 12) (Zinc finger protein 400)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 267
Molecular Weight(Da) 30813
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MAPWALLSPGVLVRTGHTVLTWGITLVLFLHDTELRQWEEQGELLLPLTFLLLVLGSLLLYLAVSLMDPGYVNVQPQPQEELKEEQTAMVPPAIPLRRCRYCLVLQPLRARHCRECRRCVRRYDHHCPWMENCVGERNHPLFVVYLALQLVVLLWGLYLAWSGLRFFQPWGQWLRSSGLLFATFLLLSLFSLVASLLLVSHLYLVASNTTTWEFISSHRIAYLRQRPSNPFDRGLTRNLAHFFCGWPSGSWETLWAEEEEEGSSPAV
Background
Function FUNCTION: Palmitoyltransferase that could catalyze the addition of palmitate onto various protein substrates. Has a palmitoyltransferase activity toward gephyrin/GPHN, regulating its clustering at synapses and its function in gamma-aminobutyric acid receptor clustering. Thereby, indirectly regulates GABAergic synaptic transmission. {ECO:0000250|UniProtKB:Q8VC90}.
Pathway
Protein Families DHHC palmitoyltransferase family
Tissue Specificity Widely expressed. {ECO:0000269|PubMed:16647879}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8740275

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human ZDHHC12 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.