Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens V-set pre-B cell surrogate light chain 3 (VPREB3) (NM_013378). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9UKI3 |
| Entry Name | VPRE3_HUMAN |
| Gene Names | VPREB3 UNQ355/PRO619 |
| Alternative Gene Names | |
| Alternative Protein Names | Pre-B lymphocyte protein 3 (N27C7-2) (Protein VPreB3) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 123 |
| Molecular Weight(Da) | 13710 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MACRCLSFLLMGTFLSVSQTVLAQLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSP |
Background
| Function | FUNCTION: Associates with the Ig-mu chain to form a molecular complex that is expressed on the surface of pre-B-cells. |
| Pathway | |
| Protein Families | Immunoglobulin superfamily |
| Tissue Specificity | Expressed in B-cell precursors. Expressed in fetal liver, bone marrow, spleen and lymph node. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |