Recombinant Human UXT protein

Specification
Description Recombinant protein from the full-length sequence of homo sapiens ubiquitously expressed prefoldin like chaperone (UXT), transcript variant 2 (NM_004182).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9UBK9
Entry Name UXT_HUMAN
Gene Names UXT HSPC024
Alternative Gene Names
Alternative Protein Names Protein UXT (Androgen receptor trapped clone 27 protein) (ART-27) (Ubiquitously expressed transcript protein)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 157
Molecular Weight(Da) 18246
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSELYMQVDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHH
Background
Function FUNCTION: Involved in gene transcription regulation (PubMed:28106301, PubMed:21730289). Acts in concert with the corepressor URI1 to regulate androgen receptor AR-mediated transcription (PubMed:11854421, PubMed:21730289). Together with URI1, associates with chromatin to the NKX3-1 promoter region (PubMed:21730289). Negatively regulates the transcriptional activity of the estrogen receptor ESR1 by inducing its translocation into the cytoplasm (PubMed:28106301). May act as nuclear chaperone that facilitates the formation of the NF-kappa-B enhanceosome and thus positively regulates NF-kappa-B transcription activity (PubMed:17620405, PubMed:21307340). Potential component of mitochondrial-associated LRPPRC, a multidomain organizer that potentially integrates mitochondria and the microtubular cytoskeleton with chromosome remodeling (PubMed:17554592). Increasing concentrations of UXT contributes to progressive aggregation of mitochondria and cell death potentially through its association with LRPPRC (PubMed:17554592). Suppresses cell transformation and it might mediate this function by interaction and inhibition of the biological activity of cell proliferation and survival stimulatory factors like MECOM (PubMed:17635584). {ECO:0000269|PubMed:11827465, ECO:0000269|PubMed:11854421, ECO:0000269|PubMed:16221885, ECO:0000269|PubMed:17554592, ECO:0000269|PubMed:17620405, ECO:0000269|PubMed:17635584, ECO:0000269|PubMed:21307340, ECO:0000269|PubMed:21730289, ECO:0000269|PubMed:28106301}.; FUNCTION: [Isoform 1]: Plays a role in protecting cells against TNF-alpha-induced apoptosis by preventing the recruitment of FADD and caspase 8 to the apoptotic complex I, composed of TRADD, TRAF2 and RIPK1/RIP. {ECO:0000269|PubMed:21307340}.
Pathway
Protein Families UXT family
Tissue Specificity Ubiquitous (PubMed:10087202, PubMed:11854421, PubMed:17635584, PubMed:11827465). Expressed in prostate epithelial cells (PubMed:21730289). Expressed in mammary epithelial cells (PubMed:28106301). Highest levels in the heart, skeletal muscle, pancreas, kidney, liver, adrenal gland, peripheral blood leukocytes, lymph node, prostate, and thyroid and the lowest levels in bladder and uterus (PubMed:11854421, PubMed:17635584, PubMed:11827465). Overexpressed in a number of tumor tissues (PubMed:11854421, PubMed:16221885, PubMed:28106301). {ECO:0000269|PubMed:10087202, ECO:0000269|PubMed:11827465, ECO:0000269|PubMed:11854421, ECO:0000269|PubMed:16221885, ECO:0000269|PubMed:17635584, ECO:0000269|PubMed:21730289, ECO:0000269|PubMed:28106301}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8520397

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human UXT protein
Copyright © 2021-present Echo Biosystems. All rights reserved.