Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens ubiquinol-cytochrome c reductase hinge protein-like (UQCRHL) (NM_001089591). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | A0A096LP55 |
| Entry Name | QCR6L_HUMAN |
| Gene Names | UQCRHL |
| Alternative Gene Names | |
| Alternative Protein Names | Cytochrome b-c1 complex subunit 6-like, mitochondrial |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 91 |
| Molecular Weight(Da) | 10752 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELYDEHVSSRSHTEEDCTEELFDFLHAKDHCVAHKLFNNLK |
Background
| Function | FUNCTION: May be a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This protein may mediate formation of the complex between cytochromes c and c1. {ECO:0000250|UniProtKB:P00127}. |
| Pathway | |
| Protein Families | UQCRH/QCR6 family |
| Tissue Specificity |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |