Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens upper zone of growth plate and cartilage matrix associated (UCMA), transcript variant 1 (NM_145314). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q8WVF2 |
| Entry Name | UCMA_HUMAN |
| Gene Names | UCMA C10orf49 |
| Alternative Gene Names | C10orf49 |
| Alternative Protein Names | Unique cartilage matrix-associated protein [Cleaved into: Unique cartilage matrix-associated protein C-terminal fragment (Ucma-C) (Gla-rich protein) (GRP)] |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 138 |
| Molecular Weight(Da) | 16563 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MTWRQAVLLSCFSAVVLLSMLREGTSVSVGTMQMAGEEASEDAKQKIFMQESDASNFLKRRGKRSPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT |
Background
| Function | FUNCTION: May be involved in the negative control of osteogenic differentiation of osteochondrogenic precursor cells in peripheral zones of fetal cartilage and at the cartilage-bone interface. {ECO:0000250}. |
| Pathway | |
| Protein Families | UCMA family |
| Tissue Specificity | Predominantly expressed in resting chondrocytes. {ECO:0000269|PubMed:16176871}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |