Recombinant Human TXN2 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens thioredoxin 2 (TXN2) (NM_012473).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q99757
Entry Name THIOM_HUMAN
Gene Names TXN2 TRX2
Alternative Gene Names TRX2
Alternative Protein Names Thioredoxin, mitochondrial (MTRX) (Mt-Trx) (Thioredoxin-2)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 166
Molecular Weight(Da) 18383
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MAQRLLLRRFLASVISRKPSQGQWPPLTSRALQTPQCSPGGLTVTPNPARTIYTTRISLTTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG
Background
Function FUNCTION: Important for the control of mitochondrial reactive oxygen species homeostasis, apoptosis regulation and cell viability. Possesses a dithiol-reducing activity. {ECO:0000269|PubMed:12032145, ECO:0000269|PubMed:12080052, ECO:0000269|PubMed:26626369}.
Pathway
Protein Families Thioredoxin family
Tissue Specificity Widely expressed in adult (at protein level) and fetal tissues. {ECO:0000269|PubMed:12032145, ECO:0000269|PubMed:12080052}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8750645

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human TXN2 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.