Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Uniprot ID | P19438 |
| Uniprot Entry Name | |
| Gene Names | TNFRSF1A |
| Alternative Names | Tumor necrosis factor receptor superfamily member 1A;Tumor necrosis factor receptor 1;TNF-R1;Tumor necrosis factor receptor type I;TNF-RI;TNFR-I;TNFAR; TNFR1 |
| Expression Region | Partial (22-211aa) |
| Molecular Weight | 23.5 kDa |
| Endotoxin | Less than 1.0 EU/µg as determined by LAL method. |
| Sequence | IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT |
| Product Form | Lyophilized powder (Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4) |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Background
| Relevance | Tumor necrosis factor receptor superfamily member 1A (Tnfrsf1a) is a member of the tumor necrosis factor receptor superfamily. Tnfrsf1a is one of the major receptors for the tumor necrosis factor-alpha. It can activate the transcription factor NF-κB, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor. Germline mutations of the extracellular domains of this receptor were found to be associated with the human genetic disorder called tumor necrosis factor associated periodic syndrome (TRAPS) or periodic fever syndrome |
| Function | Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase. |
| Involvement in disease | Familial hibernian fever (FHF); Multiple sclerosis 5 (MS5) |
| Subcellular Location | Cell membrane, Single-pass type I membrane protein, Golgi apparatus membrane, Single-pass type I membrane protein, Secreted, Note=A secreted form is produced through proteolytic processing, SUBCELLULAR LOCATION: Isoform 4: Secreted |
| Protein Families | |
| Tissue Specificity | |
| Pathway | MAPKsignalingpathway |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |