Recombinant Human TRARG1 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens trafficking regulator of GLUT4 (SLC2A4) 1 (TRARG1) (NM_172367).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q8IXB3
Entry Name TARG1_HUMAN
Gene Names TRARG1 IFITMD3 LOST1 TUSC5
Alternative Gene Names IFITMD3 LOST1 TUSC5
Alternative Protein Names Trafficking regulator of GLUT4 1 (Dispanin subfamily B member 1) (DSPB1) (Interferon-induced transmembrane domain-containing protein D3) (Protein located at seventeen-p-thirteen point three 1) (Tumor suppressor candidate 5)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 177
Molecular Weight(Da) 19254
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MAHPVQSEFPSAQEPGSAAFLDLPEMEILLTKAENKDDKTLNLSKTLSGPLDLEQNSQGLPFKAISEGHLEAPLPRSPSRASSRRASSIATTSYAQDQEAPRDYLILAVVACFCPVWPLNLIPLIISIMSRSSMQQGNVDGARRLGRLARLLSITLIIMGIVIIMVAVTVNFTVQKK
Background
Function FUNCTION: Regulates insulin-mediated adipose tissue glucose uptake and transport by modulation of SLC2A4 recycling. Not required for SLC2A4 membrane fusion upon an initial stimulus, but rather is necessary for proper protein recycling during prolonged insulin stimulation. {ECO:0000250|UniProtKB:Q8C838}.
Pathway
Protein Families CD225/Dispanin family
Tissue Specificity Expressed at high levels in heart, mammary gland, adrenal gland, stomach, smooth muscle and skeletal muscle, and at lower levels in brain and lung. Strongly down-regulated in lung cancer tissues, due to hypermethylation of the corresponding locus (PubMed:12660825). Expressed in adipose tissue (PubMed:26629404). {ECO:0000269|PubMed:12660825, ECO:0000269|PubMed:26629404}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8756015

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human TRARG1 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.