Recombinant Human TRAPPC3 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens trafficking protein particle complex 3 (TRAPPC3), transcript variant 1 (NM_014408).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID O43617
Entry Name TPPC3_HUMAN
Gene Names TRAPPC3 BET3 CDABP0066
Alternative Gene Names BET3
Alternative Protein Names Trafficking protein particle complex subunit 3 (BET3 homolog)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 180
Molecular Weight(Da) 20274
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDKMGFNIGVRLIEDFLARSNVGRCHDFRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFVELPDNHSSLIYSNLLCGVLRGALEMVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGEE
Background
Function FUNCTION: May play a role in vesicular transport from endoplasmic reticulum to Golgi.
Pathway
Protein Families TRAPP small subunits family, BET3 subfamily
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8661415

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human TRAPPC3 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.