Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Mammalian cell |
| Tag Info | Tag-Free |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Uniprot ID | P61812 |
| Uniprot Entry Name | |
| Gene Names | TGFB2 |
| Alternative Names | Transforming growth factor beta-2;TGFB2;Polyergin;G-TSF;Glioblastoma-derived T-cell suppressor factor;Cetermin;BSC-1 cell growth inhibitor;TGF-beta-2 |
| Expression Region | Full Length of Mature Protein (303-414aa) |
| Molecular Weight | 12.7 kDa |
| Endotoxin | Less than 1.0 EU/µg as determined by LAL method. |
| Sequence | ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS |
| Product Form | Lyophilized powder (Lyophilized from a 0.2 μm Filtered 4 mM HCl) |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Transforming growth factor beta-2 (TGF-β2) is a secreted protein which belongs to the TGF-beta family. It is known as a cytokine that performs many cellular functions and has a vital role during embryonic development. The precursor is cleaved into mature TGF-beta-2 and LAP, which remains non-covalently linked to mature TGF-beta-2 rendering it inactive. It is an extracellular glycosylated protein. It is known to suppress the effects of interleukin dependent T-cell tumors. Defects in TGFB2 may be a cause of non-syndromic aortic disease (NSAD). |
| Function | TGF-beta 2 has suppressive effects on interleukin-2 dependent T-cell growth. |
| Involvement in disease | Loeys-Dietz syndrome 4 (LDS4) |
| Subcellular Location | Secreted |
| Protein Families | TGF-beta family |
| Tissue Specificity | |
| Pathway | Hipposignalingpathway |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |